PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006783m
Common NameCARUB_v10006783mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 251aa    MW: 28853.1 Da    PI: 10.2859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006783mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed+ l ++v+q+G+++W+ Ia+++  gR++k+c++rw++ 
  Carubv10006783m 19 RGHWRPVEDDNLRQLVEQYGPKNWNFIAQHLY-GRSGKSCRLRWYNQ 64
                     899****************************9.************96 PP

2Myb_DNA-binding55.11.8e-1771114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++T+eE+e+l++a++  G++ W++Iar ++ gRt++ +k++++ 
  Carubv10006783m  71 KNPFTEEEEERLLKAHRIQGNR-WASIARLFP-GRTDNAVKNHFHV 114
                      689*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.4871469IPR017930Myb domain
SuperFamilySSF466895.24E-2917112IPR009057Homeodomain-like
SMARTSM007173.4E-141867IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-252072IPR009057Homeodomain-like
CDDcd001672.30E-132263No hitNo description
PfamPF139211.3E-162282No hitNo description
PROSITE profilePS5129418.34570120IPR017930Myb domain
SMARTSM007171.8E-1470118IPR001005SANT/Myb domain
CDDcd001674.41E-1173113No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2073118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEMSRGSNSF DSKKPSCQRG HWRPVEDDNL RQLVEQYGPK NWNFIAQHLY GRSGKSCRLR  60
WYNQLDPNIT KNPFTEEEEE RLLKAHRIQG NRWASIARLF PGRTDNAVKN HFHVIMARRK  120
RENSSSMATS TSNQTLHNVL SPISTVTRLN RSQFGLWRYQ KNKSRGLWPY SFVPAPRDDE  180
FGSSSVSNIR HEIYLERRTS KELVDHHNHT FHGATEDHNK TSGEDGPSKG NDVGKNNVTF  240
IDFLGVGLTS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-35151193107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9490860.0GU949086.1 Capsella grandiflora clone Cg934_31_TS3_AT4G33450_553 AT4G33450-like protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285386.10.0hypothetical protein CARUB_v10006783mg
TrEMBLR0GN170.0R0GN17_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_70006541e-163(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.11e-160myb domain protein 69